PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G371100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 274aa    MW: 29185.4 Da    PI: 4.8472
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G371100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.1e-171764148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l+  ++++G  tW+++a+  g++R++k+c++rw +yl
  Brast01G371100.1.p 17 KGLWSPEEDERLYARITRHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 64
                        678*******************************************97 PP

2Myb_DNA-binding42.61.4e-1374112545
                         -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +  E+e +v + k lG++ W+ Ia++m+ gRt++++k++w+
  Brast01G371100.1.p  74 SRREEETIVSLQKSLGNR-WSVIAARMP-GRTDNEIKNYWN 112
                         667***************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.0331268IPR017930Myb domain
SMARTSM007172.1E-121666IPR001005SANT/Myb domain
SuperFamilySSF466891.84E-2716111IPR009057Homeodomain-like
PfamPF002492.2E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-201871IPR009057Homeodomain-like
CDDcd001677.88E-112064No hitNo description
SMARTSM007172.2E-1269117IPR001005SANT/Myb domain
PROSITE profilePS5129416.16669119IPR017930Myb domain
CDDcd001677.08E-1072112No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2272118IPR009057Homeodomain-like
PfamPF002492.6E-1174113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MVEKTAVVGE AAAKERKGLW SPEEDERLYA RITRHGVSTW SSVAQLAGLR RSGKSCRLRW  60
MNYLRPDLKK EPISRREEET IVSLQKSLGN RWSVIAARMP GRTDNEIKNY WNSRIRKRQS  120
VVVTSSGGGA NGDPPAAAAE TLELAAAAPA GEEKEPFSSA AAPPARLPVF ACQLPAGSGD  180
GGGAINAAPQ STTTEQNGAG SESEVSVGGG GEENYYYYRA GGEEDMDMIG HLLSFDDLEY  240
PAPAGGGDLL MDAWESQLYC TANSGGSSID LFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241711827127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE6508361e-127HE650836.1 Brachypodium sylvaticum genomic construct, BACs 73P1 and 17E7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232989.11e-142PREDICTED: myb-related protein Myb4
TrEMBLA0A0Q3FXC01e-142A0A0Q3FXC0_BRADI; Uncharacterized protein
STRINGMLOC_19052.11e-105(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-47myb domain protein 86